PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1186s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 822aa    MW: 93518.4 Da    PI: 4.9788
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1186s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS215.82.3e-6653661374
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                             l++ L+ecA+a+++g+l+ a++l +++  ++s ++  +++++++yf+eAL +rl++    ly   p+   + ++ ++      +  +
  SapurV1A.1186s0050.1.p   5 LIDKLMECAKAIEDGELKHADSLFKEIALQSSTEAnLATRKVVKYFAEALVRRLYQ----LYPRNPMPLVRFREDTDI-----IGCK 82 
                             5789**************************9999856******************9....664444444432223333.....3457 PP

                    GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisq.GlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                               P+l f+  t     ++a+ g+++vHiiDf+++    Q ++L++ La+  ++  s RiT vg++ s +   l+ +   L+k Ae+ 
  SapurV1A.1186s0050.1.p  83 FEPFLSFASYTIMPPFYDALRGKKQVHIIDFSVTVdIWQHATLMKVLANELGSRLSYRITFVGPKLSRHLGYLKLMSLILSKTAENN 169
                             88*******************************86257**************************9999******************* PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFler 256
                             +++fe++  +a++++++   +L++ +   +Ea++V + ++lh+ll+ ++++ +    v++ +k+l+P+v+v+veqeadhns+++++r
  SapurV1A.1186s0050.1.p 170 HIDFEYEEYLANSVAEIVGATLQLGRrskEEAVVVEWEFELHKLLAVPTAVFN---LVMSKLKDLKPEVMVIVEQEADHNSPDLVDR 253
                             ********9999*****999998877778****************99999999...******************************* PP

                    GRAS 257 flealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                             ++++++yys++fdsl e k+ + ++ r+  Er  ++ +i++vva+eg  + erhet ++Wr+rl +aGF+p+++    +    +l +
  SapurV1A.1186s0050.1.p 254 LTKSFDYYSVMFDSLeEDKFEKLEDYRVLWERI-FRSQISKVVAAEGVGHAERHETWAQWRDRLFRAGFHPARI----MFRETMLFN 335
                             ***************888998888889999988.*************************************986....555566776 PP

                    GRAS 343 kvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             +   + yr+ee++   +l+  d p    SaW+
  SapurV1A.1186s0050.1.p 336 NKT-NQYRIEEKNRRPLLCRLDYPFAISSAWK 366
                             666.56*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.2951351IPR005202Transcription factor GRAS
PfamPF035147.9E-645366IPR005202Transcription factor GRAS
PROSITE profilePS5080811.621770821IPR003656Zinc finger, BED-type
SMARTSM006143.2E-10770820IPR003656Zinc finger, BED-type
PfamPF028921.6E-5773815IPR003656Zinc finger, BED-type
SuperFamilySSF576672.14E-5773818No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MAPPLIDKLM ECAKAIEDGE LKHADSLFKE IALQSSTEAN LATRKVVKYF AEALVRRLYQ  60
LYPRNPMPLV RFREDTDIIG CKFEPFLSFA SYTIMPPFYD ALRGKKQVHI IDFSVTVDIW  120
QHATLMKVLA NELGSRLSYR ITFVGPKLSR HLGYLKLMSL ILSKTAENNH IDFEYEEYLA  180
NSVAEIVGAT LQLGRRSKEE AVVVEWEFEL HKLLAVPTAV FNLVMSKLKD LKPEVMVIVE  240
QEADHNSPDL VDRLTKSFDY YSVMFDSLEE DKFEKLEDYR VLWERIFRSQ ISKVVAAEGV  300
GHAERHETWA QWRDRLFRAG FHPARIMFRE TMLFNNKTNQ YRIEEKNRRP LLCRLDYPFA  360
ISSAWKPDLT HDESLSMEIC DLGSMLGSFN IAQDASRESG KASNSVSHED DADDDIIMMK  420
GNIWSTECFS INQVAASAEI FDILEYVCHV HDLPMALTWI SDRRADDKNS REKFRLHVVD  480
TACFVNDVGM KGFFEACVEG PPLEEGQGVA GKALQSKMQF VPDVADLDAI DYPFLHVAWE  540
FGLHAVLAIK LASTYMRSVD YILEFVFPLE MREISAQSLL VNEIVSILQK NSRNSWIVCN  600
EELSRANICS EVEIMAEEVG TITITPAAIP ASQPPELSEI GSLNSSQARY LCNILYPPGD  660
EVRVPETHDQ EVEQQNSIFR PAADHFNTSE VEIMAEEVGT NTITQAAIPA SQPPELAEIG  720
CLSSFSWLNV NQPGDEVRVP ETHDQEVEQQ NSTFRPAADH SNTGTRRKRR RTSEVWLYFD  780
EVIENGEVWA KCRNCITKYR GEGKRGTTNL RKHLRLCTGM K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-1743663375GRAS family transcription factor containing p
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1766770RKRRR
2766771RKRRRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043655.10.0PREDICTED: uncharacterized protein LOC105139054
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2062935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.13e-65GRAS family protein